General Information

  • ID:  hor000657
  • Uniprot ID:  Q8WQ55
  • Protein name:  Allatostatin 1
  • Gene name:  ast
  • Organism:  Gryllus bimaculatus (Two-spotted cricket)
  • Family:  Allatostatin family
  • Source:  Animal
  • Expression:  brain
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Gryllus (genus), Gryllinae (subfamily), Gryllidae (family), Grylloidea (superfamily), Gryllidea (infraorder), Ensifera (suborder), Orthoptera (order), Polyneoptera (cohort), Neoptera (infraclass), Pterygota (subclass), Dicondylia, Insecta (class), Hexapoda (subphylum), Pancrustacea, Mandibulata, Arthropoda (phylum), Panarthropoda, Ecdysozoa, Protostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  NA
  • GO BP:  NA
  • GO CC:  NA

Sequence Information

  • Sequence:  AQHQYSFGL
  • Length:  9(160-168)
  • Propeptide:  PASDAAAAQEAAGELLERLENEAGSGATPDDELEFYKRLYDFGVGKRAYSYVSEYKRLPVYNFGLGKRAGGRQYGFGLGKRAGGRQYGFGLGKRTPGDEDDYYFPDEEEEDVPEDNLDDSDSVDKRDRLYSFGLGKRSRPFGFGLGKRAGMYSFGLGKRAQHQYSFGLGKRGEGRMYSFGLGKRPNYERMAGSRFNFGLGKRADANPAYLLSDLGEEKRGPDHRFAFGLGKREVSPNELEAVREEQLHHDKEAQQ
  • Signal peptide:  NA
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Inhibition of juvenile hormone synthesis
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: 10(-8) to 7* 10(-8) M
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-Q8WQ55-F1(AlphaFold_DB_ID)

  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
    •    hor000657_AF2.pdbhor000657_ESM.pdb

Physical Information

Mass: 119302 Formula: C48H67N13O14
Absent amino acids: CDEIKMNPRTVW Common amino acids: Q
pI: 7.54 Basic residues: 1
Polar residues: 3 Hydrophobic residues: 3
Hydrophobicity: -47.78 Boman Index: -863
Half-Life: 4.4 hour Half-Life Yeast: >20 hour
Half-Life E.Coli: >10 hour Aliphatic Index 54.44
Instability Index: 51.11 Extinction Coefficient cystines: 1490
Absorbance 280nm: 186.25

Literature

  • PubMed ID:  7673141
  • Title:  A Family of Neuropeptides That Inhibit Juvenile Hormone Biosynthesis in the Cricket, Gryllus Bimaculatus